PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P18180_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 634aa    MW: 68968 Da    PI: 7.2669
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P18180_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-093473841954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSMUA_Achr6P18180_001 347 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 384
                            554459******************************88 PP

2BELL124.93.1e-40214285172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            erqelq+kkakL+++l+eV++rY+qy++q+q+vissFeavag+gsa+ Yt+lAl++iS++FrcL+dai++qi
  GSMUA_Achr6P18180_001 214 ERQELQMKKAKLINMLDEVEQRYRQYHHQMQIVISSFEAVAGYGSARTYTALALRTISKQFRCLRDAITGQI 285
                            79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.6E-63140283IPR006563POX domain
PfamPF075267.0E-50146282IPR006563POX domain
PROSITE profilePS5007112.179325388IPR001356Homeobox domain
CDDcd000869.63E-13328389No hitNo description
SMARTSM003892.3E-9328392IPR001356Homeobox domain
SuperFamilySSF466896.42E-17329394IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28331394IPR009057Homeodomain-like
PfamPF059203.3E-18345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MATYFHGAPE IQPDGLQTLY LMNPSYVGYS DAAAPANMVL LNSTLNSMNP INLAQASQPN  60
HHQQQQFVGI PLQTAAQPHE SYRPPPIHAP HDLSAAQGLS LSLSPHDMVA PAPEITPASA  120
NGATTVASAS MMPGAANGAS GSQSFLMGSK YLKAAQQLLD EVVNVEKGIK SEPAKGATSK  180
DPADSSNAEL KCLGAGATDD NSKEKQVADL TTAERQELQM KKAKLINMLD EVEQRYRQYH  240
HQMQIVISSF EAVAGYGSAR TYTALALRTI SKQFRCLRDA ITGQIQATSK SLGEEESKSG  300
GSRLRFIDHH LRQQRALQQL GMIQPNAWRP QRGLPERSVS VLRAWLFEHF LHPYPKDSDK  360
MMLAKQTGLT RSQVSNWFIN ARVRLWKPMV EEMYLEEIKD QEQNNSDENA SKSDAHGSST  420
SKSNAPQEGS PTATPPSDSL KNDLKQTLAS VQPSSFVHGQ NQAYYDRDAI AQPRVKKARS  480
NDSPHVNPMA NPLTVGSKPD ETSNHEILMQ LMDGRQGVGE QGYPLLAGTT SHGGNYGAYP  540
MGELRTFDAE HFSRRFSGNG VSLTLGLQHS GNLPLSGAQA SLLSSDSMRL GRRLETSSEG  600
SDYCSLNHNT AAAHSSNAAF RADRGLLLNY YQAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16334392563Homeobox protein Meis2
3k2a_B3e-16334392563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404911.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-135BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM0T8160.0M0T816_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P18180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-108BEL1-like homeodomain 1